Sign In | Join Free | My
Search by Category
Home > Chemicals > Other Organic Chemicals >

Sermorelin Acetate Side Effects

sermorelin acetate side effects

All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

Total 9935 products from sermorelin acetate side effects Manufactures & Suppliers
Quality Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building for sale

Brand Name:SD

Model Number:99%

Place of Origin:shenzhen,china

...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier


Quality LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 for sale


Model Number:86168-78-7

Place of Origin:CHINA

...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier


Quality Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss for sale

Brand Name:steriodshow

Model Number:86168-78-7

Place of Origin:china manufactuer

... Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description:

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier


Quality Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate for sale

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier


Quality 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder for sale

Brand Name:Muscle Man

Model Number:400

Place of Origin:Hunan,China

...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier


Quality 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning for sale

Brand Name:HongKong Blue

Model Number:CAS No.: 86168-78-7

Place of Origin:CHINA

...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ...

HongKong Blue Universal Co., Limited.
Verified Supplier


Quality Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder for sale

Brand Name:Sermorelin

Model Number:87616-84-0

Place of Origin:china

...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ...

Pharmlab Co.,Ltd
Verified Supplier


Quality White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 for sale

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:WUHAN

... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier


Quality Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available for sale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Effective Weight Loss Drug Orlistat CAS 96829-58-2 Fermented and Synthesis for sale

Brand Name:shinrezing

Model Number:96829-58-2

Place of Origin:China

Product Description Description Orlistat CAS:96829-58-2 Molecular formula: C29H53NO5 Molecular weight: 495.7348 Assay: 99.6% Boiling point: 615.9°C at 760 mmHg Flash point: 326.3°C Appearance: Off white powder Description: Orlistat (also known as ...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier


Quality Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 For Breast Cancer for sale

Brand Name:TJ

Model Number:107868-30-4

Place of Origin:CHINA

...-4 for Breast Cancer Name: Exemestane CAS NO: 107868-30-4 Assay: 99% Appearance: White Crystalline Powder Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 for Breast Cancer Quick Detail: Product Name...

zhuhai TianJian Chemical Co.,Ltd.
Verified Supplier


Quality Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial for sale

Brand Name:Shuangbojie

Model Number:Sermorelin Acetate

Place of Origin:China

... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate...

Zhuhaishi Shuangbojie Technology Co., Ltd
Active Member


Quality Strength Enhancement Peptide Hormones Bodybuilding Sermorelin Acetate for sale

Brand Name:wumeitech

Model Number:86168-78-7

Place of Origin:China

... Hormones Bodybuilding Sermorelin Acetate Sermorelin Details: Sermorelin Spefication 2mg/vial Sermorelin Synonyms Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin CAS No. 86168-78-7 Sermorelin M F C149H246N44O42S Sermorelin M W 3357.88 Sermorelin Usage...

Zhuhai Wumei Technology Co.,ltd.
Active Member


Quality Sermorelin Acetate Powder for sale

Place of Origin:China

... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

Wuhan changdashun Technology Co., Ltd
Site Member


Quality Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee for sale

Brand Name:Youngshe

Model Number:YSPI

Place of Origin:Chengdu , China

...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

Chengdu Youngshe Chemical Company
Active Member

Quality Sermorelin Acetate for sale

Brand Name:YC

Place of Origin:wuhan china

...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Wuhan Yuancheng Gongchuang Technology Co.,Ltd
Active Member


Quality High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 for sale

Brand Name:JNJG

Model Number:86168-78-7

Place of Origin:CHINA

...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree...

Jinan  Jiage  Biological Technology Co.,Ltd
Active Member


Quality Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide for sale

Place of Origin:China

...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member


Quality Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH for sale


Model Number:2 mg/vial

Place of Origin:China

... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

Hongkong Kangdisen Medical Co., Limited
Active Member

Hong Kong

Quality Sermorelin Acetate Anti-Aging Gh Sermorelin /Sermorelin Acetate 2mg/Vial 86168-78-7 for sale

Brand Name:Sermorelin Acetate

Model Number:86168-78-7

Place of Origin:China

...Anti-Aging Gh Sermorelin /Sermorelin Acetate 2mg/Vial 86168-78-7 Hexarelin (or just HEX) is a hormones peptide which contains a short chain ...

JCJ Logis Co.,ltd
Active Member


Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request