Sign In | Join Free | My webtextiles.com
webtextiles.com
Products
Search by Category
Home > Chemicals > Chemical Alcohol >

Sermorelin Acetate Side Effects

sermorelin acetate side effects

All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

Total 9212 products from sermorelin acetate side effects Manufactures & Suppliers
Quality LGRF 1-29 Sermorelin Acetate Peptides For Building Muscle CAS 86168-78-7 for sale

Brand Name:Saichuang

Model Number:86168-78-7

Place of Origin:Wuhan,Hubei

... first 29 amino acids is actually what is responsible for stimulating pituitary response. The name Sermorelin is the prescription drug name and this alone is why it is so widely prescribed...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 for sale

Brand Name:YUANHANG

Model Number:86168-78-7

Place of Origin:CHINA

...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate for sale

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning for sale

Brand Name:HongKong Blue

Model Number:CAS No.: 86168-78-7

Place of Origin:CHINA

...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder for sale

Brand Name:Sermorelin

Model Number:87616-84-0

Place of Origin:china

...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed for sale

Brand Name:TINGYI

Model Number:10161-34-9

Place of Origin:China

... Step Guide For Making Tren Ace 100 Oil. The recipe for 1000 ml of trenbolone acetate @ 100 mg/ml we use: powders: 100 grams; BA: 2%, 20 ML BB: 10%, 100 ML...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available for sale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality for sale

Brand Name:Yihan

Place of Origin:China

Model Number:86168-78-7

...Bodybuilding Peptides Sermorelin Acetate 2mg/vial Human Growth Hormones For Fat Loss Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Sermorelin Acetate Human Growth Hormone Anti Aging CAS 86168-78-7 For Adults for sale

Brand Name:ORIPHARM

Model Number:XALY

Place of Origin:China

...Sermorelin Acetate Growth Human Peptides for Anti Aging CAS 86168-78-7 Product Name Sermorelin Acetate CAS No. 86168-78-7 Synonyms Sermorelina; Sermorelinum; Sermoreline Molecular Formula C149H246N44O42S Molecular Weight 3357.882 g·mol−1 Structure ...

Xi'an Oripharm Technology Co.,Ltd
Verified Supplier

Shaanxi

Quality Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder for sale

Brand Name:Top Pharm

Model Number:86168-78-7

Place of Origin:China

...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu...

TOP PHARM CO.,LIMITED
Verified Supplier

Quality 302.41 MW Most Effective Prohormone , Synthetic Steroid Hormones 7 - Keto - DHEA for sale

Brand Name:HW Steroid Hormones Powder

Model Number:Pharmaceutical Grade Steroid Hormones Powder

Place of Origin:China

Prohormones Steroid Hormones Powder 7-Keto-Dehydroepiandrosterone 7-Keto-DHEA for Muscle Building 566-19-8 COA: Product Name 7-Keto-DHEA Batch NO. 20150508 Test Date 2015.05.08 Quantity 15kg Expiry Date 2017.05.07 Manufacturing 2015.05.08 Test ...

Shenzhen Haiwen Bio-Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Sermorelin CAS 86168-78-7 Muscle Building Sterods Growth Hormone Releasing Hormones for sale

Brand Name:Keray

Model Number:86168-78-7

Place of Origin:China

... Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate Product Name: Sermorelin Unit size: 2 mg/vial CAS NO.: 86168-78-7 Synonyms: GRF 1-29 Sequence...

Shenzhen Keray Biotech Co., Ltd
Verified Supplier

Guangdong

Quality Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building for sale

Brand Name:SD

Model Number:99%

Place of Origin:shenzhen,china

...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ...

Shenzhen Sendi Biotechnology Co.Ltd.
Active Member

Guangdong

Quality Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial for sale

Brand Name:Shuangbojie

Model Number:Sermorelin Acetate

Place of Origin:China

... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate...

Zhuhaishi Shuangbojie Technology Co., Ltd
Active Member

Guangdong

Quality Sermorelin Acetate Powder for sale

Place of Origin:China

... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

Wuhan changdashun Technology Co., Ltd
Site Member

Hubei

Quality Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee for sale

Brand Name:Youngshe

Model Number:YSPI

Place of Origin:Chengdu , China

...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

Chengdu Youngshe Chemical Company
Active Member

Quality Sermorelin Acetate for sale

Brand Name:YC

Place of Origin:wuhan china

...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Wuhan Yuancheng Gongchuang Technology Co.,Ltd
Active Member

Hubei

Quality High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 for sale

Brand Name:JNJG

Model Number:86168-78-7

Place of Origin:CHINA

...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree...

Jinan  Jiage  Biological Technology Co.,Ltd
Active Member

Shandong

Quality Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide for sale

Place of Origin:China

...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Quality Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH for sale

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

Hongkong Kangdisen Medical Co., Limited
Active Member

Hong Kong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request